. JSON.stringify is\n safe-by-construction. */\n gtag('config', \"G-VZF1EHLEDH\");\n ","id":"ga-init"}])
← All Products

System of Record · Revenue & Growth

OwnCRM

Pipeline. Forecast. Coverage. Execution.

The revenue operating system for sales organisations. Unifies pipeline management, forecasting, account coverage, and rep execution into one surface, purpose-built for the leader accountable to the board.

ReplacesSalesforceHubSpotPipedrive
74%

In week one. Not year one.

01

The forecast rolls up board-ready on its own — no spreadsheet post-processing the night before.

02

Deals at risk surface in the cockpit before the pipeline review, not during it.

03

Reps stop costing per seat — one licence covers the whole team on your infrastructure.

And the Salesforce renewal stops being a line item — the replacement is an asset you own. Run your numbers →

74%10-year cost reduction vs. SaaS CRM
2 wkTypical deployment to go-live
0Per-seat fees after licence
100%Data stays on your infrastructure
OwnCRM — actual product interface

What sets it apart

01

Board-ready forecasts without spreadsheet post-processing

02

Pipeline coverage and deal risk signals in a single dashboard

03

Marketing campaigns and ROI tracking built into the CRM — no separate tool

Key Capabilities

01

Revenue Cockpit

Pipeline coverage, deals at risk, win-rate, and commit visibility in a single dashboard for board-ready forecasting without post-processing.

02

Kanban Pipeline

Stage gates with drag-to-advance, saved filters, owner rollups, and sortable pipeline list view for keyboard-first rep adoption.

03

Forecast Module

Commit, best-case, and pipeline projections rolled up by team and month — with deal-risk signals surfaced before the review call.

04

Marketing Campaigns

ROI tracking, campaign management, and automations integrated directly into the CRM. No separate marketing tool required.

Who it’s for

VP Sales

Eliminate forecast calls — every deal, risk, and commit is visible in real time.

Rev Ops

Unify pipeline, territory, and comp data in one model. No ETL from three SaaS tools.

CRO

Board-ready revenue analytics without a BI team stitching Salesforce reports together.

Perpetual Licence

OwnCRM is available as a perpetual licence. You own the software forever. Deploy on your infrastructure. No annual renewals, no per-seat pricing, no vendor lock-in. Prefer OpEx? A managed subscription is available too — switch between the two anytime, nothing to re-buy.

Every screen here also works without the screen.

OwnCRM implements the Own360 headless spec: a standard /api/v1 surface with OpenAPI, cursor pagination, idempotent writes, and entity.changed events — drivable from its own CLI, any HTTP client, MCP tools generated straight from its OpenAPI, and the OwnAgents runtime.

$ owncrm entities            # 11 entities
$ owncrm contact list --limit 20
$ owncrm contact create --data '{…}'
$ owncrm domain advance_deal

The generated OwnCRM CLI — every entity and domain op, OwnAuth-authenticated, idempotent by default.

Entities

contactcompanydealleadactivitycampaigntasknotequotepipelinesequence

Domain ops

advance_dealimport_contacts

15 verified agent tasks · 4 cross-app workflows

  • OwnCRM → OwnTasksOwnCRM deal in negotiation → OwnTasks follow-up task that carries the deal id
  • OwnCRM → OwnERP → OwnBooksQuote-to-cash: OwnCRM contact + deal -> OwnERP sales order -> OwnBooks invoice + payment, ids chained end-to-end
  • OwnCRM → OwnSocial → OwnChat → OwnBIMarketing funnel: OwnCRM campaign -> OwnSocial post -> OwnChat notification -> OwnBI funnel dashboard
  • OwnCRM → OwnChatOwnCRM deal closed -> OwnChat announcement carrying the deal id

See the full task catalog in the agent runtime →

Inside OwnCRM

The full story — why it exists, what it replaces, every capability in detail, and real product screens.

Read the deep dive →